General Information

  • ID:  hor004159
  • Uniprot ID:  P55089
  • Protein name:  Urocortin
  • Gene name:  UCN
  • Organism:  Homo sapiens (Human)
  • Family:  Sauvagine/corticotropin-releasing factor/urotensin I family
  • Source:  Human
  • Expression:  Keratinocytes in epidermis and the outer and inner root sheaths of hair follicles, epithelium of sebaceous and sweat glands, erector pili muscle, cutaneous blood vessel walls, cutaneous nerves and dermal mononuclear cells .
  • Disease:  Diseases associated with UCN include Ulcerative Colitis and Colitis.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding; GO:0046811 histone deacetylase inhibitor activity; GO:0051430 corticotropin-releasing hormone receptor 1 binding; GO:0051431 corticotropin-releasing hormone receptor 2 binding
  • GO BP:  GO:0001934 positive regulation of protein phosphorylation; GO:0001964 startle response; GO:0006979 response to oxidative stress; GO:0007186 G protein-coupled receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007565 female pregnancy; GO:0007605 sensory perception of sound; GO:0007611 learning or memory; GO:0007631 feeding behavior; GO:0008306 associative learning; GO:0009060 aerobic respiration; GO:0010628 positive regulation of gene expression; GO:0010629 negative regulation of gene expression; GO:0010996 response to auditory stimulus; GO:0030307 positive regulation of cell growth; GO:0031175 neuron projection development; GO:0032099 negative regulation of appetite; GO:0032355 response to estradiol; GO:0032755 positive regulation of interleukin-6 production; GO:0032967 positive regulation of collagen biosynthetic process; GO:0033138 positive regulation of peptidyl-serine phosphorylation; GO:0035176 social behavior; GO:0042311 vasodilation; GO:0042756 drinking behavior; GO:0043066 negative regulation of apoptotic process; GO:0043117 positive regulation of vascular permeability; GO:0043524 negative regulation of neuron apoptotic process; GO:0043950 positive regulation of cAMP-mediated signaling; GO:0045727 positive regulation of translation; GO:0045740 positive regulation of DNA replication; GO:0045776 negative regulation of blood pressure; GO:0045792 negative regulation of cell size; GO:0045944 positive regulation of transcription by RNA polymerase II; GO:0046888 negative regulation of hormone secretion; GO:0048265 response to pain; GO:0051384 response to glucocorticoid; GO:0051461 positive regulation of corticotropin secretion; GO:0051966 regulation of synaptic transmission, glutamatergic; GO:0060452 positive regulation of cardiac muscle contraction; GO:0090280 positive regulation of calcium ion import; GO:2000252 negati
  • GO CC:  GO:0005576 extracellular region; GO:0030424 axon; GO:0030425 dendrite; GO:0043025 neuronal cell body; GO:0043196 varicosity; GO:0043204 perikaryon; GO:0043679 axon terminus

Sequence Information

  • Sequence:  DNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV
  • Length:  40
  • Propeptide:  MRQAGRAALLAALLLLVQLCPGSSQRSPEAAGVQDPSLRWSPGARNQGGGARALLLLLAERFPRRAGPGRLGLGTAGERPRRDNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSVGK
  • Signal peptide:  MRQAGRAALLAALLLLVQLCPGSSQ
  • Modification:  T40 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  34-34R->A: Reduced affinity for CRHR1.; 36-36R->A: Reduced affinity for CRHR1.; 37-37R->A: Reduced affinity for CRHR1.; 40-40R->A: Reduced affinity for CRHR1.

Activity

  • Function:  Acts in vitro to stimulate the secretion of adrenocorticotropic hormone;Plays a role in the establishment of normal hearing thresholds; Reduces food intake and regulates ghrelin levels in gastric body and plasma.
  • Mechanism:  Positive correlation between increased expression in colonic lamina propria and severity of inflammation in patients with ulcerative colitis.
  • Cross BBB:  NO
  • Target:  CRHR1, CRHR2
  • Target Unid:  P34998, Q13324
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 54±3 minutes; /3240 seconds ( PubMed ID: 15882144 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  2rmf(PDB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    2rmf.pdbhor004159_AF2.pdbhor004159_ESM.pdb

Physical Information

Mass: 539311 Formula: C204H336N62O65
Absent amino acids: CGKMWY Common amino acids: L
pI: 5.68 Basic residues: 6
Polar residues: 9 Hydrophobic residues: 15
Hydrophobicity: -44 Boman Index: -11424
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 109.75
Instability Index: 4837.5 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  8612563
  • Title:  Cloning and characterization of human urocortin.
  • PubMed ID:  10690896
  • Title:  The Skin Produces Urocortin.
  • PubMed ID:  15531481
  • Title:  Urocortin 1 in colonic mucosa in patients with ulcerative colitis.
  • PubMed ID:  15882144
  • Title: